EMR1 Polyclonal antibody proteintech 27044-1-AP
$449.00
In stock
SKU
27044-1-AP
ADGRE1, Adhesion G protein-coupled receptor E1, EGF like module receptor 1, EMR1, EMR1 hormone receptor, F4/80, TM7LN3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag25883 Product name: Recombinant human EMR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-510 aa of BC059395 Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 886 aa, 97 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC059395 |
| Conjugate: Unconjugated | Gene Symbol: EMR1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2015 |
| Application: Western Blot (WB) | RRID: AB_2716814 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: EMR1 (EGF-like module containing mucin-like hormone receptor 1), also known as Adhesion G protein-coupled receptor E1 (ADGRE1), is a surface receptor with seven transmembrane segments that belong to the EGF-7-transmembrane family of G protein-coupled receptors (PMID: 14647991, 7601460). EMR1 expression is restricted to eosinophilic granulocytes, where expression is overlapping with the eotaxin receptor CCR3 and the immunoglobulin-like lectin Siglec-8. Absence on other leukocytes, including basophils, implies that EMR1 is a highly specific marker for eosinophils in humans and may be used as a novel therapeutic target for eosinophilic disorders (PMID: 17823986, 24530099). F4/80, the murine homolog of EMR1, is a marker of murine macrophage. The apparent molecular weight of F4/80 is 160 kDa, which is larger than the calculated molecular weight due to post-translational modifications (PMID: 7308288; 8647179). |
Reviews
Write Your Own Review