C5aR Polyclonal antibody proteintech 21316-1-AP
$449.00
In stock
SKU
21316-1-AP
C5AR1, C5A, C5a anaphylatoxin chemotactic receptor 1, C5a R, C5a-R
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag15968 Product name: Recombinant human C5AR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 251-350 aa of BC008982 Sequence: FFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 350 aa, 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC008982 |
| Conjugate: Unconjugated | Gene Symbol: C5aR |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 728 |
| Application: Western Blot (WB) | RRID: AB_10733105 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: C5aR, also named as CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
