TRAF2 Polyclonal antibody proteintech 26846-1-AP
$449.00
In stock
SKU
26846-1-AP
E3 ubiquitin-protein ligase TRAF2, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRAF2, TNF receptor-associated factor 2, TRAP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (4) | Immunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032410 |
| Conjugate: Unconjugated | Gene Symbol: TRAF2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7186 |
| Application: Western Blot (WB) | RRID: AB_2880656 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression through multiple pathways. |
Reviews
Write Your Own Review