RUNX1 (middle) Polyclonal antibody proteintech 25315-1-AP
$449.00
In stock
SKU
25315-1-AP
RUNX1, AML1, AML1 EVI 1, AMLCR1, CBF alpha 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag17838 Product name: Recombinant human RUNX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 214-277 aa of BC136381 Sequence: TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSP Predict reactive species |
| Applications: WB, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA | Observed Molecular Weight: 480 aa, 52 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC136381 |
| Conjugate: Unconjugated | Gene Symbol: RUNX1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 861 |
| Application: Western Blot (WB) | RRID: AB_2880026 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Runt-related transcription factor 1 (RUNX1), also named AML1 or CBF alpha 2, is a 453 amino acid protein, which contains one Runt domain. RUNX1 localizes in the nucleus and is expressed in all tissues except the brain and heart. RUNX1 is involved in hematopoiesis and is frequently targeted in human leukemia by chromosomal translocations that fuse the DNA-binding domain of RUNX1 to other transcription factors and corepressor molecules. In addition to its role in leukemogenesis, RUNX1 is also involved in sensory neuron diversification. RUNX1 exists in some isoforms with a range of MV 20-52 kDa. The calculated molecular weight of isoform 1 is 49 kDa, but the modified protein is about 49-55 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
