SLC1A5/ASCT2 Polyclonal antibody proteintech 20350-1-AP
$449.00
In stock
SKU
20350-1-AP
SLC1A5, AAAT, ASCT2, ATB(0), ATBO
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (3) | Immunogen: CatNo: Ag14182 Product name: Recombinant human RDRC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 436-541 aa of BC000062 Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA | Observed Molecular Weight: 541 aa, 57 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000062 |
| Conjugate: Unconjugated | Gene Symbol: SLC1A5/ASCT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6510 |
| Application: Western Blot (WB) | RRID: AB_2878679 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
