RBM3 Polyclonal antibody proteintech 14363-1-AP
$449.00
In stock
SKU
14363-1-AP
RNPL, RNA-binding protein 3, RNA-binding motif protein 3, RNA binding motif protein 3, Putative RNA binding protein 3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag5934 Product name: Recombinant human RBM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC006825 Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, RIP, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006825 |
| Conjugate: Unconjugated | Gene Symbol: RBM3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5935 |
| Application: Western Blot (WB) | RRID: AB_2269266 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: RBM3, also named as RNPL, is a cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. It reduces the relative abundance of microRNAs, when overexpressed. RBM3 enhances phosphoryaltion of translation initiation factors and active polysome formation. It is up-regulated in human tumors. RBM3 is a potential proto-oncogenic proteins upon overexpression. (PMID: 19900510 ). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
