Collagen Type III (N-terminal) Polyclonal antibody proteintech 22734-1-AP
$449.00
In stock
SKU
22734-1-AP
COL3, COL3A1, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain, Collagen Type III
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (6) | Immunogen: CatNo: Ag18658 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-152 aa of BC028178 Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA | Observed Molecular Weight: 1466 aa, 139 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC028178 |
| Conjugate: Unconjugated | Gene Symbol: COL3A1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1281 |
| Application: Western Blot (WB) | RRID: AB_2879158 |
| Dilution: WB : 1:300-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen detects type III procollagen at 140-180 kDa and also in some lysates reveals a 70-kDa band which has been reported and may represent a cleaved form of type III procollagen (PMID: 17424834; 19648160; 22802960). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
