VEGF-C Polyclonal antibody proteintech 22601-1-AP
$449.00
In stock
SKU
22601-1-AP
VEGFC, vascular endothelial growth factor C, Vascular endothelial growth factor-related protein, VEGF C
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 419 aa, 47 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC035212 |
| Conjugate: Unconjugated | Gene Symbol: VEGFC |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7424 |
| Application: Western Blot (WB) | RRID: AB_2879132 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
