Alpha smooth muscle actin Polyclonal antibody proteintech 23081-1-AP
$449.00
In stock
SKU
23081-1-AP
ACTA2, Alpha SMA, a-SMA, smooth muscle actin, Alpha actin 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag19481 Product name: Recombinant human ACTA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC017554 Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 377 aa, 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC017554 |
| Conjugate: Unconjugated | Gene Symbol: Alpha smooth muscle actin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 59 |
| Application: Western Blot (WB) | RRID: AB_2815024 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: ACTA2 (also known as α-smooth muscle actin or α-SMA) belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. ACTA2 is primarily expressed in vascular smooth muscle and anti-ACTA2 is commonly used to marker smooth muscle cells. This antibody is specific to the ACTA2. It selectively stains the vascular smooth muscle but not cardiac or skeletal muscle. |
Reviews
Write Your Own Review