SLC7A11/xCT Polyclonal antibody proteintech 26864-1-AP
$449.00
In stock
SKU
26864-1-AP
SLC7A11, xCT, Amino acid transport system xc, Amino acid transport system xc-, CCBR1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (4) | Immunogen: CatNo: Ag25431 Product name: Recombinant human SLC7A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC012087 Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKR Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, RIP, ELISA | Observed Molecular Weight: 55 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012087 |
| Conjugate: Unconjugated | Gene Symbol: SLC7A11 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 23657 |
| Application: Western Blot (WB) | RRID: AB_2880661 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SLC7A11 (also known as xCT) is a membrane transporter involved in the uptake of cystine. It promotes glutathione synthesis through the uptake of cystine and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers including lung cancer. The SLC7A11 protein appears at two molecular weights, 55?kDa and 35?kDa, and the 55 kDa protein is ubiquitinated(PMID: 32188872). 26864-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
