WNT3A Polyclonal antibody proteintech 26744-1-AP
$449.00
In stock
SKU
26744-1-AP
Protein Wnt 3a, Protein Wnt-3a
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag25051 Product name: Recombinant human WNT3A protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 250-350 aa of BC103921 Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT Predict reactive species |
| Applications: WB, IF, ELISA | Observed Molecular Weight: 352 aa, 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC103921 |
| Conjugate: Unconjugated | Gene Symbol: WNT3A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 89780 |
| Application: Western Blot (WB) | RRID: AB_2918108 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: WNT3A belongs to wingless-type MMTV integration site family, and abnormal Wnt signalling is often associated with severe human diseases, including cancer, osteoporosis and other degenerative disorders. WNT3A is a secreted glycoprotein that is involved in both canonical and non-canonical Wnt signaling pathways. The canonical Wnt pathway, also known as the β-catenin-dependent pathway, regulates gene expression by stabilizing β-catenin, which then translocates to the nucleus and interacts with transcription factors like TCF/LEF. It's shown to promote trophectoderm formation in embryonic stem cells. It's reported that the canonical Wnt/β-catenin signaling pathway also contributes to the carcinogenesis and progression of lung cancer cell lines. The non-canonical pathways, which are β-catenin-independent, are involved in cytoskeletal organization and cell polarity. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
