XBP-1U specific Polyclonal antibody proteintech 25997-1-AP
$449.00
In stock
SKU
25997-1-AP
XBP1, Tax-responsive element-binding protein 5, TREB-5, X box binding protein 1, X-box-binding protein 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag21714 Product name: Recombinant human XBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 167-261 aa of BC000938 Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Predict reactive species |
| Applications: WB, IHC, IF, FC (Intra), IP, ELISA | Observed Molecular Weight: 261 aa, 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000938 |
| Conjugate: Unconjugated | Gene Symbol: XBP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7494 |
| Application: Western Blot (WB) | RRID: AB_2880326 |
| Dilution: WB : 1:200-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa. This antibody 25997-1-AP specially recognizes isoform XBP-1U. |
Reviews
Write Your Own Review