S100A8 Polyclonal antibody proteintech 15792-1-AP
$449.00
In stock
SKU
15792-1-AP
CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag8500 Product name: Recombinant human S100A8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 93 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005928 |
| Conjugate: Unconjugated | Gene Symbol: S100A8 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6279 |
| Application: Western Blot (WB) | RRID: AB_10666315 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. S100A8 may form homodimer or heterodimer with S100A9(16216873). |
Reviews
Write Your Own Review