APJ/APLNR Polyclonal antibody proteintech 20341-1-AP
$449.00
In stock
SKU
20341-1-AP
APJ, AGTRL1, Angiotensin receptor-like 1, APLNR, G-protein coupled receptor APJ
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag14138 Product name: Recombinant human APLNR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC032688 Sequence: NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 380 aa, 43 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032688 |
| Conjugate: Unconjugated | Gene Symbol: APJ |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 187 |
| Application: Western Blot (WB) | RRID: AB_2878676 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: APJ, also named APLNR and AGTRL1, belongs to the G-protein coupled receptor 1 family. It is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. APJ is an alternative coreceptor with CD4 for HIV-1 infection. It may be involved in the development of AIDS dementia. APJ is expressed abundantly in the corpus callosum and spinal cord. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
