ZIP8 Polyclonal antibody proteintech 20459-1-AP
$449.00
In stock
SKU
20459-1-AP
BIGM103, PP3105, SLC39A8, ZIP 8, ZIP8
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse and More (3) | Immunogen: CatNo: Ag14292 Product name: Recombinant human SLC39A8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-143 aa of BC012125 Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 460 aa, 50 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012125 |
| Conjugate: Unconjugated | Gene Symbol: ZIP8 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 64116 |
| Application: Western Blot (WB) | RRID: AB_10697830 |
| Dilution: WB : 1:500-1:2400 | Conjugate: Unconjugated |
| Tested Reactivity: human, mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SLC39A8, also known as ZIP8, belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Recently it was found that ZIP8 expression is upregulated in human monocytes in response to LPS, TNF-α, and live bacteria, facilitating cytoprotection during the early inflammation. Besides zinc ZIP8 can also transport cadmium and manganese efficiently. It is predicted that ZIP8 contains 3 potential N-linked glycosylation sites and is subject to glycosylation, which may account for the presences of multiple molecular weights, such as 43 kDa, 49 kDa, 60 kDa, 75-90 kDa, 150 kDa, and 200 kDa. |
Reviews
Write Your Own Review