TMEM175 Polyclonal antibody proteintech 19925-1-AP
$449.00
In stock
SKU
19925-1-AP
Transmembrane protein 175, hTMEM175
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag13890 Product name: Recombinant human TMEM175 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 222-313 aa of BC005158 Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 504 aa, 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005158 |
| Conjugate: Unconjugated | Gene Symbol: TMEM175 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 84286 |
| Application: Western Blot (WB) | RRID: AB_10666166 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: TMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability. It has two isoforms with MW 41-45 kDa and 54-60 kDa. For optimal WB detection with this antibody, we recommend avoiding boiling the sample after lysis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
