SLC2A9 Polyclonal antibody proteintech 26486-1-AP
$449.00
In stock
SKU
26486-1-AP
Urate transporter, GLUTX, GLUT-9, GLUT9
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag24135 Product name: Recombinant human SLC2A9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 443-511 aa of BC018897 Sequence: IQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 540 aa, 59 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018897 |
| Conjugate: Unconjugated | Gene Symbol: SLC2A9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 56606 |
| Application: Western Blot (WB) | RRID: AB_2880532 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
