SIGMAR1 Polyclonal antibody proteintech 15168-1-AP
$449.00
In stock
SKU
15168-1-AP
Sigma 1-type opioid receptor, Sigma 1 type opioid receptor, OPRS1, hSigmaR1, Aging-associated gene 8 protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Zebrafish And More (1) | Immunogen: CatNo: Ag7351 Product name: Recombinant human SIGMAR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-223 aa of BC004899 Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC004899 |
| Conjugate: Unconjugated | Gene Symbol: SIGMAR1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10280 |
| Application: Western Blot (WB) | RRID: AB_2301712 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Zebrafish | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 28 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa. |
Reviews
Write Your Own Review