SCD1 Polyclonal antibody proteintech 28678-1-AP
$449.00
In stock
SKU
28678-1-AP
SCD, Acyl CoA desaturase, Acyl-CoA desaturase, Delta(9) desaturase, Delta(9)-desaturase
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
| Applications: WB, IHC, IF/ICC, CoIP, ELISA | Observed Molecular Weight: 355 aa, 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005807 |
| Conjugate: Unconjugated | Gene Symbol: SCD |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6319 |
| Application: Western Blot (WB) | RRID: AB_2923581 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580). |
Reviews
Write Your Own Review