TOM20 Polyclonal antibody proteintech 11802-1-AP
$449.00
In stock
SKU
11802-1-AP
TOMM20, KIAA0016, MAS20, MOM19, tom 20
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Chicken And More (6) | Immunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 145 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000882 |
| Conjugate: Unconjugated | Gene Symbol: TOM20 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9804 |
| Application: Western Blot (WB) | RRID: AB_2207530 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Chicken | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review