Sodium iodide symporter Polyclonal antibody proteintech 24324-1-AP
$449.00
In stock
SKU
24324-1-AP
NIS, Natrium iodide transporter, SLC5A5, Sodium-iodide symporter (Na(+)/I(-) symporter)
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag19504 Product name: Recombinant human SLC5A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 538-643 aa of BC105047 Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL Predict reactive species |
| Applications: WB, IHC, IF, IP, ChIP, ELISA | Observed Molecular Weight: 643 aa, 69 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC105047 |
| Conjugate: Unconjugated | Gene Symbol: Sodium iodide symporter |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6528 |
| Application: Western Blot (WB) | RRID: AB_2879495 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The sodium iodide symporter (Na+/I - symporter, NIS), encoded by SLC5A5, is an integral plasma membrane glycoprotein that plays an important role in iodide uptake by thyroid cells. Expression of sodium iodide symporter has also been found in extra-thyroidal tissues, including gastric mucosa, lactating mammary gland and salivary glands. Increased expression of sodium iodide symporter has been found in thyroid tissue from patients with Graves' disease as well as papillary thyroid carcinomas. In addition, sodium iodide symporter was found to express in majority of breast cancer tissue but not in normal tissue. Sodium iodide symporter can be a promising diagnostic and therapeutic tool for thyroid cancer and breast cancer. This antibody recognizes the mature approximately 75-100 kDa protein and a partially glycosylated 50-55 kDa protein. (PMID: 12588808, 9525971) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
