IFT81 Polyclonal antibody proteintech 11744-1-AP
$449.00
In stock
SKU
11744-1-AP
Carnitine deficiency-associated protein expressed in ventricle 1, CDV 1, CDV 1R, CDV1, CDV-1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat, canine | Immunogen: CatNo: Ag2339 Product name: Recombinant human IFT81 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 550-676 aa of BC029349 Sequence: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 676 aa, 80 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029349 |
| Conjugate: Unconjugated | Gene Symbol: IFT81 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 28981 |
| Application: Western Blot (WB) | RRID: AB_2121966 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Canine | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT particles are multi-subunit complexes of proteins that functions to move non-membrane-bound particles from the cell body to the tip of cilium or flagellum, then return them to the cell body. Transport towards the ciliary tip is regulated by the IFT complex B (IFT-B), consisting of at least 15 IFT proteins, in association with kinesin motors, whereas transport from the ciliary tip back to the base is executed by a dynein motor in association with the IFT complex A (IFT-A), currently known to be composed of six IFT proteins. IFT81 is a subunit of IFT complex B.It may play a role in development of the testis and spermatogenesis. There are some isoforms of IFT81 with 73-78 kDa and 43-50 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
