AXIN2 Polyclonal antibody proteintech 20540-1-AP
$449.00
In stock
SKU
20540-1-AP
Axin-2, Axil, axin 2, Axin like protein, Axin-like protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag14574 Product name: Recombinant human AXIN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 843 aa, 94 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006295 |
| Conjugate: Unconjugated | Gene Symbol: AXIN2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8313 |
| Application: Western Blot (WB) | RRID: AB_10694569 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Axis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer. Catalgo#20540-1-AP is a rabbit polyclonal antibdy raised against a 34 amino acid N-terminal of human AXIN2. Observed MW of AXIN2 is from 93-100 kDa (PMID: 11809809; 24607787). |
Reviews
Write Your Own Review