S100A11 Polyclonal antibody proteintech 10237-1-AP
$449.00
In stock
SKU
10237-1-AP
Calgizzarin, MLN 70, MLN70, Protein S100 A11, Protein S100 C
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-105 aa of BC001410 Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, Neutralization, ELISA | Observed Molecular Weight: 105 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001410 |
| Conjugate: Unconjugated | Gene Symbol: S100A11 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6282 |
| Application: Western Blot (WB) | RRID: AB_2183478 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: S100A11 (also known as S100C or calziggarin), is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs (PMID: 18694925). S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation (PMID: 15241500). Chromosomal rearrangements and altered expression of S100A11 have been implicated in tumor metastasis. This S100A11 antibody (10237-1-AP) has also been instrumental in investigations into S100A11's role in the development of brain tumors in tuberous sclerosis complex (TSC) patients (PMID: 20133820). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
