MCP-1/CCL2 Polyclonal antibody proteintech 26161-1-AP
$449.00
In stock
SKU
26161-1-AP
Ccl2, MCP1, MCP-1, C-C motif chemokine 2, CCL 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Mouse And More (2) | Immunogen: CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 16-20 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: MCP-1/CCL2 |
| Conjugate: Unconjugated | Gene Symbol: 20296 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2918100 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation. |
Reviews
Write Your Own Review