DKK1 Polyclonal antibody proteintech 21112-1-AP
$449.00
In stock
SKU
21112-1-AP
Dkk-1, DKK 1, Dickkopf-related protein 1, Dickkopf-1, Dickkopf1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag15110 Product name: Recombinant human DKK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-191 aa of BC001539 Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 266 aa, 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001539 |
| Conjugate: Unconjugated | Gene Symbol: DKK1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 22943 |
| Application: Western Blot (WB) | RRID: AB_10733097 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment. |
Reviews
Write Your Own Review