VAPB Polyclonal antibody proteintech 14477-1-AP
$449.00
In stock
SKU
14477-1-AP
ALS8, UNQ484/PRO983, VAMP associated protein B/C, VAMP B, VAMP B/VAMP C
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag5857 Product name: Recombinant human VAPB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 27 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001712 |
| Conjugate: Unconjugated | Gene Symbol: VAPB |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9217 |
| Application: Western Blot (WB) | RRID: AB_2288297 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late-onset spinal muscular atrophy. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
