SMMHC Polyclonal antibody proteintech 21404-1-AP
$449.00
In stock
SKU
21404-1-AP
MYH11, KIAA0866, Myosin 11, Myosin heavy chain 11, Myosin-11
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag16114 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1208-1316 aa of BC104906 Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 1979 aa, 228 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC104906 |
| Conjugate: Unconjugated | Gene Symbol: SMMHC/MYH11 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4629 |
| Application: Western Blot (WB) | RRID: AB_10732819 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
