BDNF Polyclonal antibody proteintech 25699-1-AP
$449.00
In stock
SKU
25699-1-AP
Brain-derived neurotrophic factor, brain derived neurotrophic factor, BDNF precursor form
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag22489 Product name: Recombinant human BDNF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 130-179 aa of BC029795 Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 247 aa, 28 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029795 |
| Conjugate: Unconjugated | Gene Symbol: BDNF |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 627 |
| Application: Western Blot (WB) | RRID: AB_3669493 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
