NPPA Polyclonal antibody proteintech 27426-1-AP
$449.00
In stock
SKU
27426-1-AP
ANP, PND, ANF, ATFB6, Atrial natriuretic factor
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag26692 Product name: Recombinant human NPPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-153 aa of BC005893 Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 153 aa, 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005893 |
| Conjugate: Unconjugated | Gene Symbol: NPPA |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4878 |
| Application: Western Blot (WB) | RRID: AB_2880868 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA?is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
