LATS1 Polyclonal antibody proteintech 17049-1-AP
$449.00
In stock
SKU
17049-1-AP
EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1, WARTS
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag10709 Product name: Recombinant human LATS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species |
| Applications: WB, IHC, IF/ICC, RIP, ELISA | Observed Molecular Weight: 15 kDa, 127 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015665 |
| Conjugate: Unconjugated | Gene Symbol: LATS1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9113 |
| Application: Western Blot (WB) | RRID: AB_2281011 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445). |
Reviews
Write Your Own Review