HEY1 Polyclonal antibody proteintech 19929-1-AP
$449.00
In stock
SKU
19929-1-AP
bHLHb31, CHF 2, CHF2, CHF-2, HERP2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag13906 Product name: Recombinant human HEY1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-295 aa of BC001873 Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ChIP, ELISA | Observed Molecular Weight: 304 aa, 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001873 |
| Conjugate: Unconjugated | Gene Symbol: HEY1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 23462 |
| Application: Western Blot (WB) | RRID: AB_10646438 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Hairy/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
