SREBF2 Polyclonal antibody proteintech 28212-1-AP
$449.00
In stock
SKU
28212-1-AP
bHLHd2, Class D basic helix-loop-helix protein 2, Processed sterol regulatory element-binding protein 2, SREBF 2, SREBP 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (5) | Immunogen: CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species |
| Applications: WB, IP, CoIP, ELISA | Observed Molecular Weight: 124 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC056158 |
| Conjugate: Unconjugated | Gene Symbol: SREBF2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6721 |
| Application: Western Blot (WB) | RRID: AB_2881091 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
