CXCL12/SDF-1 Polyclonal antibody proteintech 17402-1-AP
$449.00
In stock
SKU
17402-1-AP
CXCL12, C-X-C motif chemokine 12, hIRH, hSDF-1, IRH
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag11379 Product name: Recombinant human CXCL12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-89 aa of BC039893 Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, ELISA | Observed Molecular Weight: 89 aa, 10 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: CXCL12/SDF-1 |
| Conjugate: Unconjugated | Gene Symbol: 6387 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2878404 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:50-1:500 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755).?It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240).?CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ).?In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). This antibody can detect all the isoforms of CXCL12/SDF1. |
Reviews
Write Your Own Review