S100A10 Polyclonal antibody proteintech 11250-1-AP
$449.00
In stock
SKU
11250-1-AP
ANX2L, ANX2LG, CAL1L, Calpactin 1 light chain, Calpactin I light chain
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag1779 Product name: Recombinant human S100A10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC, IP, ELISA | Observed Molecular Weight: 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015973 |
| Conjugate: Unconjugated | Gene Symbol: S100A10 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6281 |
| Application: Western Blot (WB) | RRID: AB_2269906 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis. |