GABARAPL1 Polyclonal antibody proteintech 11010-1-AP
$449.00
In stock
SKU
11010-1-AP
APG8 LIKE, APG8L, ATG8, ATG8L, Early estrogen-regulated protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009309 |
| Conjugate: Unconjugated | Gene Symbol: GABARAPL1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 23710 |
| Application: Western Blot (WB) | RRID: AB_2294415 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene, and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy, like GABARAP and GABARAPL2, and may be considered an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle, and at very low levels in the thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2. |
Reviews
Write Your Own Review