AGTR1 Polyclonal antibody proteintech 25343-1-AP
$449.00
In stock
SKU
25343-1-AP
AG2S, AGTR1A, AGTR1B, Angiotensin II type 1 receptor, Angiotensin II type-1 receptor
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 359 aa, 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022447 |
| Conjugate: Unconjugated | Gene Symbol: AGTR1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 185 |
| Application: Western Blot (WB) | RRID: AB_2880037 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, and salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580). |
Reviews
Write Your Own Review