RIPK3 Polyclonal antibody proteintech 29080-1-AP
$449.00
In stock
SKU
29080-1-AP
RIP3, RIP like protein kinase 3, RIP 3, Receptor-interacting serine/threonine-protein kinase 3, Receptor-interacting protein 3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag30337 Product name: Recombinant human RIPK3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-202 aa of BC062584 Sequence: HDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTAS Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 518 aa, 57 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC062584 |
| Conjugate: Unconjugated | Gene Symbol: RIPK3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 11035 |
| Application: Western Blot (WB) | RRID: AB_3086097 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: RIPK3,also named as RIP3, a Ser/Thr kinase of RIP (Receptor Interacting Protein) family, is recruited to the TNFR1 signaling complex through RIP and has been shown to mediate apoptosis induction and NF-κB activation. RIPK3 is a nucleocytoplasmic shuttling protein and its unconventional nuclear localization signal (NLS, 442-472 aa) is sufficient to trigger apoptosis in the nucleus(PMID:18533105). It has 3 isoforms produced by alternative splicing. RIPK3 might form a homodimer within cells, and its apoptotic activity may not be required for this dimerization(PMID:18533105). |
Reviews
Write Your Own Review