Histone H4 Polyclonal antibody proteintech 16047-1-AP
$449.00
In stock
SKU
16047-1-AP
HIST1H4E, HIST1H4A, H4C5, H4C4, H4C3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag8999 Product name: Recombinant human Histone H4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC012587 Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA | Observed Molecular Weight: 102 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012587 |
| Conjugate: Unconjugated | Gene Symbol: Histone H4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8367 |
| Application: Western Blot (WB) | RRID: AB_2118625 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Histone H4 is a 103 amino acid protein, which belongs to the histone H4 family. Histone H4 localizes in the nucleus and is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Reviews
Write Your Own Review