CXCL8/IL-8 Polyclonal antibody proteintech 27095-1-AP
$449.00
In stock
SKU
27095-1-AP
CXCL8, IL8, IL-8, C X C motif chemokine 8, Chemokine
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag25640 Product name: Recombinant human CXCL8/IL-8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-99 aa of BC013615 Sequence: YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 99 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013615 |
| Conjugate: Unconjugated | Gene Symbol: IL-8 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3576 |
| Application: Western Blot (WB) | RRID: ENSG00000169429 |
| Dilution: WB : 1:500-1:2000 | Conjugate: AB_2861340 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: Interleukin 8 (IL-8), also known as CXCL8, which is a member of the CXC chemokine family. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. The human IL-8 cDNA sequence predicts a protein of 99 amino acids. Removal of a 22-residue signal peptide generates a mature protein of 77 amino acids (~ 8 kDa). |
Reviews
Write Your Own Review