calreticulin Polyclonal antibody proteintech 27298-1-AP

$449.00
In stock
SKU
27298-1-AP

 

CALR, Calregulin, CRT

Host / Isotype: Rabbit / IgG Class: Polyclonal
Reactivity: Human, Mouse, Rat And More (1) Immunogen: CatNo: Ag26064 Product name: Recombinant human calreticulin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-417 aa of BC002500 Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL Predict reactive species
 Applications: WB, IHC, IF/ICC, FC (Intra), ELISA Observed Molecular Weight: 60 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC002500
Conjugate: Unconjugated Gene Symbol: Calreticulin
Tested Applications: Positive WB detected in Gene ID (NCBI): 811
Application: Western Blot (WB) RRID: AB_2880835
Dilution: WB : 1:20000-1:100000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Rabbit / IgG Background Information: CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

 

 

Reviews

Write Your Own Review
You're reviewing:calreticulin Polyclonal antibody proteintech 27298-1-AP
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.