calreticulin Polyclonal antibody proteintech 27298-1-AP
$449.00
In stock
SKU
27298-1-AP
CALR, Calregulin, CRT
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag26064 Product name: Recombinant human calreticulin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 248-417 aa of BC002500 Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 60 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002500 |
| Conjugate: Unconjugated | Gene Symbol: Calreticulin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 811 |
| Application: Western Blot (WB) | RRID: AB_2880835 |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment. |
Reviews
Write Your Own Review