LDHA Polyclonal antibody proteintech 21799-1-AP
$449.00
In stock
SKU
21799-1-AP
Cell proliferation-inducing gene 19 protein, EC:1.1.1.27, lactate dehydrogenase A, LDH A, LDH-A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag16703 Product name: Recombinant human LDHA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-332 aa of BC067223 Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 332 aa, 37 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC067223 |
| Conjugate: Unconjugated | Gene Symbol: LDHA |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3939 |
| Application: Western Blot (WB) | RRID: AB_10858925 |
| Dilution: WB : 1:5000-1:30000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087). |
Reviews
Write Your Own Review