IFT20 Polyclonal antibody proteintech 13615-1-AP
$449.00
In stock
SKU
13615-1-AP
hIFT20, Intraflagellar transport protein 20 homolog
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Canine And More (1) | Immunogen: CatNo: Ag4521 Product name: Recombinant human IFT20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC038094 Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC038094 |
| Conjugate: Unconjugated | Gene Symbol: IFT20 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 90410 |
| Application: Western Blot (WB) | RRID: AB_2280001 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Canine | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. |
Reviews
Write Your Own Review