CXCL1 Polyclonal antibody proteintech 12335-1-AP
$449.00
In stock
SKU
12335-1-AP
C X C motif chemokine 1, C-X-C motif chemokine 1, CXCL 1, GRO-alpha(4-73), GRO-alpha(5-73)
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human | Immunogen: CatNo: Ag2917 Product name: Recombinant human CXCL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC011976 Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Predict reactive species |
| Applications: WB, IHC, IF, ELISA, Cell treatment | Observed Molecular Weight: 8 kDa to 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011976 |
| Conjugate: Unconjugated | Gene Symbol: CXCL1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2919 |
| Application: Western Blot (WB) | RRID: AB_2087568 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers. |
Reviews
Write Your Own Review