Cyclin B1 Polyclonal antibody proteintech 28603-1-AP

$449.00
In stock
SKU
28603-1-AP

 

CCNB1, CCNB, Cyclin B, G2/mitotic specific cyclin B1, G2/mitotic-specific cyclin-B1

Host / Isotype: Rabbit / IgG Class: Polyclonal
Reactivity: Human, Rat And More (6) Immunogen: CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species
 Applications: WB, IHC, IF/ICC, FC (Intra), IP, ELISA Observed Molecular Weight: 48 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC006510
Conjugate: Unconjugated Gene Symbol: Cyclin B1
Tested Applications: Positive WB detected in Gene ID (NCBI): 891
Application: Western Blot (WB) RRID: AB_2881179
Dilution: WB : 1:1000-1:8000 Conjugate: Unconjugated
Tested Reactivity: Human, Rat Form: Liquid
Host / Isotype: Rabbit / IgG Background Information: Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.

 

 

Reviews

Write Your Own Review
You're reviewing:Cyclin B1 Polyclonal antibody proteintech 28603-1-AP
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.