Cyclin B1 Polyclonal antibody proteintech 28603-1-AP
$449.00
In stock
SKU
28603-1-AP
CCNB1, CCNB, Cyclin B, G2/mitotic specific cyclin B1, G2/mitotic-specific cyclin-B1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Rat And More (6) | Immunogen: CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, ELISA | Observed Molecular Weight: 48 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006510 |
| Conjugate: Unconjugated | Gene Symbol: Cyclin B1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 891 |
| Application: Western Blot (WB) | RRID: AB_2881179 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation. |