Connexin 43 Polyclonal antibody proteintech 26980-1-AP
$449.00
In stock
SKU
26980-1-AP
GJA1, Connexin-43, GJAL, Gap junction alpha-1 protein, Gap junction alpha 1 protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag25533 Product name: Recombinant human Connexin 43 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 232-382 aa of BC026329 Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Predict reactive species |
| Applications: WB, IHC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 43 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC026329 |
| Conjugate: Unconjugated | Gene Symbol: Connexin-43 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2697 |
| Application: Western Blot (WB) | RRID: AB_2880711 |
| Dilution: WB : 1:3000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490). |
Reviews
Write Your Own Review