NR1H4 Polyclonal antibody proteintech 25055-1-AP
$449.00
In stock
SKU
25055-1-AP
BAR, Bile acid receptor, Farnesoid X activated receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag21878 Product name: Recombinant human NR1H4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC130573 Sequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 486 aa, 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC130573 |
| Conjugate: Unconjugated | Gene Symbol: NR1H4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9971 |
| Application: Western Blot (WB) | RRID: AB_2879874 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Nuclear Receptor subfamily 1, group H, member 4 (NR1H4, also known as FXR) is a receptor for bile acids and has an important role in regulating energy metabolism in liver, muscle and adipose tissues in humans and animals. NR1H4 is highly expressed in liver and has a role in lipid metabolism, whereas none of the other protein-coding genes in the region has known biological links with cholesterol, further supporting a role for NR1H4 in regulation of cholesterol levels. NR1H4 have five isoforms, each isoform has a different expressional level and transcriptional activity depending on its location within specific tissues. (PMID:?14733360, PMID:?30787420) |
Reviews
Write Your Own Review