CPT1B-specific Polyclonal antibody proteintech 22170-1-AP
$449.00
In stock
SKU
22170-1-AP
CPT1B, Carnitine O palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase I-like protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (4) | Immunogen: CatNo: Ag17840 Product name: Recombinant human CPT1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-250 aa of BC131570 Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 567 aa, 64 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC131570 |
| Conjugate: Unconjugated | Gene Symbol: CPT1B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1375 |
| Application: Western Blot (WB) | RRID: AB_2713959 |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Carnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88/84/79/66 kDa. |
Reviews
Write Your Own Review