S100A9 Recombinant monoclonal antibody proteintech 83578-2-RR
$449.00
In stock
SKU
83578-2-RR
CFAG, Calprotectin L1H subunit, Calgranulin-B, Calgranulin B, CAGB
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human | Immunogen: CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 13 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC047681 |
| Conjugate: Unconjugated | Gene Symbol: S100A9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6280 |
| Application: Western Blot (WB) | RRID: AB_3671190 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
