GLUT2 Polyclonal antibody proteintech 20436-1-AP
$449.00
In stock
SKU
20436-1-AP
GLUT-2, SLC2A2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag14204 Product name: Recombinant human SLC2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 57 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC060041 |
| Conjugate: Unconjugated | Gene Symbol: GLUT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6514 |
| Application: Western Blot (WB) | RRID: AB_2750600 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |